PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC007297.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NZZ/SPL
Protein Properties Length: 73aa    MW: 8059.11 Da    PI: 10.8963
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC007297.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE26.51.2e-0820594886
        NOZZLE 48 gsktaqqkqkkptlrgmgvaklerfiieeekkkl.vvatv 86
                     + +qkqkk   rg+gva+le+ +iee++k   +va+v
  EcC007297.50 20 TRSSKKQKQKKVPQRGLGVARLEKIRIEEQQKSHaTVAAV 59
                  23346899*********************99987445544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087442.9E-62058IPR014855Plant transcription factor NOZZLE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0015031Biological Processprotein transport
GO:0016020Cellular Componentmembrane
GO:0003676Molecular Functionnucleic acid binding
GO:0005509Molecular Functioncalcium ion binding
GO:0005515Molecular Functionprotein binding
GO:0005525Molecular FunctionGTP binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MGQEEKNPKR SISSYGGVRT RSSKKQKQKK VPQRGLGVAR LEKIRIEEQQ KSHATVAAVS  60
TLTPPQDSDP DVS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300416.29e-13hypothetical protein POPTR_0001s38460g
TrEMBLA0A059BN067e-13A0A059BN06_EUCGR; Uncharacterized protein
TrEMBLB9GGG11e-12B9GGG1_POPTR; Uncharacterized protein